PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G24220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 331aa    MW: 35324.9 Da    PI: 6.7122
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G24220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.54.4e-5651301128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++
  OPUNC03G24220.1   5 LPPGFRFHPTDEELVTYYLTRKVSDFGFAT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIFH 97 
                      79*************************999.89***************999999**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g lvg+kktLvfy+grapkg kt+Wvmheyrl
  OPUNC03G24220.1  98 -GGVLVGMKKTLVFYRGRAPKGAKTSWVMHEYRL 130
                      .*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-653151IPR003441NAC domain
PROSITE profilePS5100560.7195151IPR003441NAC domain
PfamPF023652.5E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLTRKVSDF GFATRAIADV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFHGGV LVGMKKTLVF YRGRAPKGAK  120
TSWVMHEYRL QSKFPYKPSK DEWVVCRVFK KCHLAVKPRP PHDDGDGDGA SPPEMVDGST  180
TSLGELGELD VSSILLGGFA PPSGALCHGG SGGGGGGDGF GAHRLDLGAY MSWLQAAANQ  240
GAAAAGMFQW PATQGLLGGT VFAANPAAAH KAAAGMPFGA GCSQPRDVGV SLANVGGGDA  300
LFGGAPLAKV DMECGEQAPQ LDMDDSTWRA F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-57415716171NO APICAL MERISTEM PROTEIN
1ut4_B2e-57415716171NO APICAL MERISTEM PROTEIN
1ut7_A2e-57415716171NO APICAL MERISTEM PROTEIN
1ut7_B2e-57415716171NO APICAL MERISTEM PROTEIN
3swm_A3e-57415719174NAC domain-containing protein 19
3swm_B3e-57415719174NAC domain-containing protein 19
3swm_C3e-57415719174NAC domain-containing protein 19
3swm_D3e-57415719174NAC domain-containing protein 19
3swp_A3e-57415719174NAC domain-containing protein 19
3swp_B3e-57415719174NAC domain-containing protein 19
3swp_C3e-57415719174NAC domain-containing protein 19
3swp_D3e-57415719174NAC domain-containing protein 19
4dul_A2e-57415716171NAC domain-containing protein 19
4dul_B2e-57415716171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0626750.0AK062675.1 Oryza sativa Japonica Group cDNA clone:001-105-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629240.10.0PREDICTED: NAC domain-containing protein 59
TrEMBLA0A0E0KGG30.0A0A0E0KGG3_ORYPU; Uncharacterized protein
STRINGLOC_Os03g42630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.15e-93NAC domain containing protein 58